PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_05012.1_g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 429aa    MW: 47638.6 Da    PI: 9.5463
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_05012.1_g00010.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM478.5e-1536140386128
                      NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              tg d+++++ k+ +vg++k Lv+y g+apkg+kt+W+mheyrl
  Sme2.5_05012.1_g00010.1 361 TGADRDIKDDKNVTVGVRKALVYYYGKAPKGQKTNWIMHEYRL 403
                              99*******9*******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF142238.5E-958117No hitNo description
PROSITE profilePS5100513.349262429IPR003441NAC domain
SuperFamilySSF1019412.09E-14361425IPR003441NAC domain
PfamPF023655.6E-6371403IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MPLVTVTAIR MSSDRAIRTN QLLDFANKVR LFSKDFTDER IVQNIVVTLP EKSEAAISSL  60
ENLFGKDFTD ERIVQKILVT LPEKYEATIS SLENSKDLSS VTLAELVKAL QALEQRRMMR  120
KEGSVEGAFL AKSKNESNKG WKKYKKQWPK QLFVATCFAS KKASESWLID SGCTNHMTSD  180
QKLFKDLDRS FISKVKIENG EYLDARGKGT VAIESPTGTR TLSDIYQRCN VAVLEPGGFM  240
EAAKEDCNHR SITPFPDLGN KGDASMESSE NKEEETVANR SQKMAGTVNW GTATVIGVFA  300
GLFYGGSKEA AASVSKAGTV NWGTTTGYLL ASFMEVARRL LLLLARMQRI LLGMGLLGMG  360
TGADRDIKDD KNVTVGVRKA LVYYYGKAPK GQKTNWIMHE YRLHGVPDIS QRGPKDLKMD  420
DWVVYGSLF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2430404e-80AC243040.1 Solanum tuberosum chromosome 11 clone RH142N14, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016578836.11e-67PREDICTED: uncharacterized protein LOC107876422
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-15NAC family protein